dietary supplement is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Updated 2026-08-01. Numbers and descriptions here follow the published literature rather than marketing material.
Identity and purity are assessed with several complementary methods. High-performance liquid chromatography can separate creatine from creatinine and related impurities, often with ultraviolet detection. Nuclear magnetic resonance and infrared spectroscopy provide structural confirmation, while Karl Fischer titration measures water content. Elemental analysis and mass spectrometry may be used for additional confirmation, especially in research or forensic settings. No single method captures every quality attribute, so laboratories typically combine results and compare them against a specification.
Creatine monohydrate is sold as a dietary ingredient in some countries and as a food supplement in others. Regulatory frameworks vary, so purity limits, labeling rules, and permitted claims are not globally uniform. In the United States, it falls under dietary supplement rules, whereas the European Union treats it as a food supplement ingredient. Pharmacopeial monographs, where they exist, can provide public quality standards, but not every product is required to meet them. Questions about long-term effects and patterns of use remain areas of active study rather than settled regulatory findings.
Creatine was first identified in skeletal muscle extracts in the nineteenth century, and its role in phosphagen energy buffering was clarified in the twentieth century. The monohydrate salt became widely studied after methods for inexpensive synthesis and crystallization were developed. Modern research examines its effects on muscle energetics, recovery, and cognitive performance under specific conditions. Findings vary with population, exercise protocol, baseline creatine status, and measurement method. Studies often compare supplementation with placebo during controlled training or testing schedules.
Creatine monohydrate is a hydrated form of creatine, a nitrogen-containing compound involved in cellular energy metabolism. Its molecular formula is C4H9N3O2·H2O, with a molar mass around 149.15 g/mol. The monohydrate is the most common solid form used in research and commercial settings because it crystallizes readily and remains stable under ordinary conditions. The term monohydrate indicates one water molecule per creatine molecule in the crystal lattice. It appears as a white crystalline powder with low odor.
| Property | Value | Notes |
|---|---|---|
| Purity (typical) | ≥99% by HPLC | Supplement and pharmacopeial grades vary |
| Water content | ≈12.1% theoretical | Measured by Karl Fischer titration |
| Creatinine limit | Often ≤0.1% in pharmacopeial grade | Supplement specifications may differ |
| Storage conditions | 15–25 °C, low humidity | Away from heat and acidic environments |
| Common analytical methods | HPLC–UV, NMR, FTIR, Karl Fischer | Used for identity, assay, and water content |
In the body, creatine is obtained from dietary meat and fish and is also synthesized from arginine, glycine, and methionine. Muscle stores creatine and phosphocreatine, which participate in the rapid regeneration of adenosine triphosphate during short, intense activity. The monohydrate form is used in research because it is chemically defined, stable as a dry solid, and relatively inexpensive to produce. Questions remain about whether other creatine forms offer meaningful advantages in absorption or tissue retention, and findings vary across studies and populations.
Creatine monohydrate is a crystalline compound formed from creatine and one molecule of water. Creatine itself is a nitrogen-containing organic acid that occurs in vertebrate muscle and other tissues. The monohydrate designation refers to the water included in the crystal lattice, not to water added during manufacturing. Its chemical formula is commonly written as C4H9N3O2·H2O. The solid is typically a white, odorless powder with low solubility in water at room temperature. It is one of several creatine forms described in scientific and commercial literature.
Commercial creatine products appear in several forms, including monohydrate, hydrochloride, citrate, nitrate, and ethyl ester. Creatine monohydrate is the most studied form and serves as a reference material in comparative research. Different forms vary in solubility, pH, and water content, but they share creatine as the active moiety after dissolution. Claims that one form is uniformly superior remain debated, and study designs often differ in population, exercise protocol, and outcome measures. Purity and hydration state are central to interpreting product labels.
Creatine monohydrate is the hydrated form of creatine, a nitrogen-containing organic acid involved in cellular energy transfer. Its molecular formula is C4H11N3O3, and it consists of creatine plus one water molecule in the crystal lattice. The anhydrous base, creatine, has the formula C4H9N3O2. The compound appears as a white, odorless, crystalline powder and is classified as a guanidine derivative. It is distinct from creatinine, a breakdown product measured in clinical chemistry.
In animals, creatine is synthesized mainly in liver, kidney, and pancreas from arginine, glycine, and methionine. The first committed step transfers a guanidino group from arginine to glycine, forming guanidinoacetate. Subsequent methylation by S-adenosylmethionine yields creatine. Dietary sources include meat and fish; endogenous synthesis supplies part of the body pool. Most creatine is stored in skeletal muscle, where it is converted to phosphocreatine and participates in rapid regeneration of adenosine triphosphate during short, intense activity.
Analytical methods for creatine monohydrate focus on identity, purity, and degradation products. High-performance liquid chromatography with ultraviolet detection is common, often at a wavelength near 210 nanometers. Titration and nuclear magnetic resonance spectroscopy can also quantify the parent compound. Pharmacopeial monographs specify tests for appearance, solubility, water content, and related substances, including creatinine. Purity values above 99 percent are typical for pharmaceutical-grade material, though supplement-grade products vary. Independent verification can detect label discrepancies.
Sourcing and verification of creatine monohydrate involve both manufacturing origin and third-party testing. Industrial production commonly starts with sarcosine and cyanamide, followed by crystallization to obtain the monohydrate. Some products are derived from animal sources, while others are synthesized from non-animal precursors. Certificates of analysis report assay, heavy metals, and microbial limits. Regulations differ by country: in the United States it is sold as a dietary supplement, whereas in the European Union it falls under food supplement rules.
In solid form, creatine monohydrate is relatively stable when kept dry and away from heat. Moisture and elevated temperatures promote cyclization into creatinine, a related compound with no role in the phosphagen system. Degradation accelerates in aqueous solution, where the conversion can occur within hours to days depending on pH and temperature. Manufacturers typically recommend storage in sealed containers at room temperature, with relative humidity below 50 percent. Long-term stability data for opened containers are limited.
A clinical data management system (CDMS) is a tool used in clinical research to manage the data of a clinical trial. The clinical trial data gathered at the investigator site in the case report form are stored in the CDMS. To reduce the possibility of errors due to human entry, the systems employ various means to verify the data. Systems for clinical data management can be self-contained or part of the functionality of a CTMS. A CTMS with clinical data management functionality can help with the validation of clinical data as well as helps the site employ for other important activities like building patient registries and assist in patient recruitment efforts. The CDMS can be broadly divided into paper-based and electronic data capture systems.
CKLF-like MARVEL transmembrane domain-containing 5 (CMTM5), previously termed chemokine-like factor superfamily 5 (i.e. CKLFSF5), designates any one of the six protein isoforms (termed CMTM5-v1 to CMTM5-v6) encoded by six different alternative splices of its gene, CMTM5; CMTM5-v1 is the most studied of these isoforms. The CMTM5 gene is located in band 11.2 on the long (i.e. "q") arm of chromosome 14. The CMTM5 isoforms are members of the CKLF-like MARVEL transmembrane domain-containing family (CMTM). This family consists of 9 proteins although most of them are known to have one or more isoforms. These proteins are: chemokine-like factor (i.e. CLF, the founding member of the family) and CEF-like marvel transmembrane domain-containing 1 through 8 (i.e. CMTM1 through CMTM8). All of these proteins as well as the genes responsible for their production (i.e. CKLF and CMTM1 to CMTM8, respectively) have similar structures but vary in their apparent physiological and pathological functions. Preliminary studies suggest that CMTM5-v1 (which cells commonly secrete to the extracellular spaces such as the blood) or an unspecified CMTM5 isoform has various functions including involvements in regulating the autoimmune system, the development of numerous types of cancers, and the cardiovascular system.
Nanoscience and nanotechnology have been emerging as a technology for the development of various hybrid and composite materials for biomedical applications. When nanomaterials are used for the development of the composites in biology, they are called bionanocomposites. Bionanocomposites have been used in tissue engineering to replace, support, or regenerate the cells, organs, or parts of human entity such that it can function as normal. Amylopectin-based bionanocomposites are another important class of bionanomaterials, which are biodegradable, with higher mechanical properties, optical transparency, thermal stability, and barrier properties than thermoplastic starch. In conjunction with other nanomaterials like cellulose nanocrystals, nano-ZnO, nanoclay, biodegradable synthetic polymers, starch is one of the most popular materials for the preparation of bionanocomposites for various biomedical applications such as controlled drug release, scaffold for tissue engineering, and cement for bone regeneration. Amylopectin is usually combined with a synthetic polymer with higher elastic modulus and yield strength. This allows for starch to withstand the higher fluid flow and mechanical forces prevalent in bone, cardiac, and endothelial tissue.
80. Levothyroxine. Drugs and Lactation Database (LactMed®) [Internet]. Bethesda (MD): National Institute of Child Health and Human Development; 2006–. 2026 Sep 15. Levothyroxine (T4) is a normal component of human milk. Limited data on exogenous replacement doses of levothyroxine during breastfeeding indicate no adverse effects in infants. The American Thyroid Association recommends that subclinical and overt hypothyroidism should be treated with levothyroxine in lactating women seeking to breastfeed.[1] Adequate levothyroxine treatment during lactation may normalize milk production in hypothyroid lactating mothers with low milk supply, but does not return milk lipids to normal. Mothers taking levothyroxine because of gestational hypothyroidism may have lower exclusive breastfeeding rates rates at 1 month and increased early formula supplementation.[2] Levothyroxine dosage requirement may be increased in the postpartum period compared to prepregnancy requirements in patients with Hashimoto’s thyroiditis.[3]
Actin-binding proteins (also known as ABPs) are proteins that bind to actin. This may mean ability to bind actin monomers, or polymers, or both. Many actin-binding proteins, including α-actinin, β-spectrin, dystrophin, utrophin and fimbrin, do this through the actin-binding calponin homology domain. This is a list of actin-binding proteins in alphabetical order. 25kDa 25kDa ABP from aorta 30akDA 30bkDa 34kDA 45kDa 110 kD dimer ABP 110 kD (Drebrin) p53 p58gag p185neu p116rip a-actinin Abl ABLIM Actin-Interacting MAPKKK Ssk2p ABP120 ABP140 Abp1p ABP280 (Filamin) ABP50 (EF-1a) Acan 125 (Carmil) ActA Actibind Actin Actinfilin Actinogelin Actin-regulating kinases Actin-Related Proteins Actobindin Actolinkin Actopaxin Actophorin Acumentin (= L-plastin) Adducin ADF/Cofilin Adseverin (scinderin) Afadin AFAP-110 Affixin Aginactin AIP1 Aldolase Angiogenin Anillin Annexins Aplyronine Archvillin (isoform of Supervillin) Arginine kinase Arp2/3 complex Band 4.1 Band 4.9 (Dematin) b-actinin b-Cap73 Bifocal Bistramide A BPAG1 Brevin (Gelsolin)
Sources: en.wikipedia.org
As filaments grow, the pool of available G-actin molecules is managed by G-actin-binding proteins such as profilin and thymosin β-4. Profilin ensures a supply of available actin-ATP by binding to ADP-bound G-actin and promoting the exchange of ADP for ATP. Profilin's binding to the actin molecule physically blocks its addition to a filament's (−) end, but permits it to join the (+) end. Once the actin-ATP has joined the filament, profilin releases it. As formins promote the nucleation and extension of new actin filaments, they recruit profilin to the area, increasing the local concentration of actin-ATP to boost filament growth. In contrast, thymosin β-4 binds and sequesters actin-ATP, preventing it from joining a microfilament. Once an actin fiber is established, the dynamics of its growth or collapse are influenced by numerous proteins. Existing strands can be interrupted by filament cleaving proteins, such as cofilin and gelsolin. Cofilin binds along two actin-ADP molecules in a filament, forcing a movement that destabilizes the filament and causes it to break. Gelsolin inserts itself between actin molecules in a filament, disrupting the filament. After the filament breaks, gelsolin remains attached to the new (+) end, preventing it from growing, thus forcing its disassembly.
The overall fold of Acutolysin A is composed of a twisted β-sheet core flanked by α-helices, forming the characteristic metzincin architecture. Central to this fold is the conserved “Met-turn”, a methionine-containing structural motif that stabilizes the active-site configuration. The three disulfide bonds in AaH I (Cys117–Cys197, Cys159–Cys181, and Cys157–Cys164) are strategically positioned to maintain this fold under physiological conditions and to resist thermal or proteolytic degradation. These disulfide linkages play a crucial role in preserving the shape of the catalytic cleft, ensuring maximal enzymatic activity even in harsh extracellular environments. At the active site is the HELGHNLGLH metalloproteinase motif, which binds a catalytic zinc ion in a tetrahedral geometry. Three histidine residues coordinate the zinc atom, while the fourth ligand is either a water molecule or hydroxide ion, which acts as the nucleophile in peptide bond hydrolysis. The active-site cleft forms a deep groove that accommodates collagen and laminin fibers, aligning them precisely for cleavage. This structural arrangement explains the exceptional potency of AaH I in degrading basement membranes.
July 28 – August 4: 2018 Senior League Baseball World Series in Easley at Easley Recreation Complex The Pariba Little League (Caribbean) defeated the Naamans Little League (East), 7–2, in the final. July 29 – August 5: 2018 Little League Intermediate (50/70) Baseball World Series in Livermore at Max Baer Park The West Seoul LL (Asia-Pacific) defeated the Livermore/Granada LL (Host), 10–0, in the final. August 12 – 19: 2018 Junior League World Series in Taylor at Heritage Park The Shing-Ming Junior LL (Asia-Pacific) defeated the Lufkin LL (Southwest), 2–0, in the final. August 16 – 26: 2018 Little League World Series in South Williamsport at both the Little League Volunteer Stadium and the Howard J. Lamade Stadium The Honolulu LL (West) defeated the South Seoul LL (Asia-Pacific and Middle East), 3–0, in the final.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Abdurozik Savriqul Muhammadroziqi (Tajik: Абдурозиқ Савриқул Муҳаммадрозиқӣ, [æbdurɑˈzɯq sævrɯˈqul muˌɦæmːædrɑzɯˈqiː], born 23 September 2003), known professionally as Abdu Rozik, is a Tajikistani playback singer and social media influencer based in Dubai, UAE. In 2022, he participated in Bigg Boss 16 and later in Laughter Chefs – Unlimited Entertainment 2. As a child, Rozik was diagnosed with dwarfism, a growth hormone deficiency which could be cured with appropriate medical treatment. However, his family could not afford to have him treated, leading to his stunted growth. Due to his family's poverty, Rozik was often out of school. He sang for tips in markets and on streets of Panjakent in Tajikistan; along with his family, Rozik also had a beloved pet cat named Renzo, a British Shorthair, who brought him a lot of joy during difficult times.
Sources: en.wikipedia.org
The HIE-ISOLDE project introduced a network of High Energy Beam Transfer (HEBT) beamlines to the ISOLDE facility. The common section beamline, XT00, joins to three bending beamlines (XT01, XT02, XT03) leading to different experiment setups. The three identical beamlines are independent of each other, for example, if the first XT01 dipole magnet is off, the beam will continue to the XT02 and XT03. They all bend the beam by 90 degrees and focus it using two dipole magnets and a doublet-quadrupole. The XT01 beamline leads to Miniball, the XT02 beamline leads to the ISS, and the XT03 beamline leads to movable setups, such as the SEC scattering chamber. Offline 2 was recently installed as a mass separator beamline at ISOLDE, with the purpose of satisfying the increased demands on the original offline facility, Offline 1. The facility includes the beamline enclosed in a Faraday cage as well as a laser laboratory and control station. The offline facility is designed for target test studies, and upgraded to include potential for the production and study of molecular ion beams.
Site-specific recombination makes use of phage integrases instead of restriction enzymes, eliminating the need for having restriction sites in the DNA fragments. Instead, integrases make use of unique attachment (att) sites, and catalyse DNA rearrangement between the target fragment and the destination vector. The Invitrogen Gateway cloning system was invented in the late 1990s and uses two proprietary enzyme mixtures, BP clonase and LR clonase. The BP clonase mix catalyses the recombination between attB and attP sites, generating hybrid attL and attR sites, while the LR clonase mix catalyse the recombination of attL and attR sites to give attB and attP sites. As each enzyme mix recognises only specific att sites, recombination is highly specific and the fragments can be assembled in the desired sequence. Vector design and assembly Because Gateway cloning is a proprietary technology, all Gateway reactions must be carried out with the Gateway kit that is provided by the manufacturer. The reaction can be summarised into two steps. The first step involves assembling the entry clones containing the DNA fragment of interest, while the second step involves inserting this fragment of interest into the destination clone.
11-Deoxycortisol, also known as cortodoxone (INN), cortexolone as well as 17α,21-dihydroxyprogesterone or 17α,21-dihydroxypregn-4-ene-3,20-dione, is an endogenous glucocorticoid steroid hormone, and a metabolic intermediate toward cortisol. The compound was first described by Tadeusz Reichstein in 1938 as Substance S, thus has also been referred to as Reichstein's Substance S or Compound S. 11-Deoxycortisol acts as a glucocorticoid, though is less potent than cortisol. 11-Deoxycortisol is synthesized from 17α-hydroxyprogesterone by 21-hydroxylase and is converted to cortisol by 11β-hydroxylase.
In Taiwan, the Taiwan Transportation Safety Board (TTSB) is the independent government agency that is responsible for major transportation accident investigations. TTSB's predecessor was ASC, which was established in 1998. TTSB is under the administration of the Executive Yuan and independent from Civil Aviation Administration. The TTSB consisted of five to seven board members, including a chairman and a vice chairman, appointed by the Premier. The managing director of TTSB manages the day-to-day function of the organization, including accident investigations. In the United Kingdom, the agency responsible for investigation of civilian air crashes is the Air Accidents Investigation Branch (AAIB) of the Department for Transport. Its purpose is to establish the circumstances and causes of the accident and to make recommendations for their future avoidance.
This family is the largest. Their systems are found in multiple bacterial phyla. They are usually associated with various cargo enzymes like cysteine desulfurase, polyprenyl transferase, terpene cyclase, and xylulose kinase. This family can contain cyclic nucleotide-monophosphate (cNMP) binding domains and use larger N-terminal targeting domains (TDs) for cargo encapsulation. This family is split into subfamilies 2A and 2B. 2A is distinguished by the presence of cNMP binding domains. This family of encapsulins often encapsulates enzymes that are involved in sulfur and carbon metabolism. This family is the Phage capsid family. These encapsulins are found primarily within biosynthetic gene clusters. They are associated with specific pathways in Actinobacteria and Proteobacteria. Their operons might interact with lipids. They are currently putative and lack experimental validation.
Sources: en.wikipedia.org
A sealed container kept at room temperature and away from moisture is typical. Heat and humidity promote conversion to creatinine and can reduce assay values. Long-term storage under dry conditions helps maintain the original crystalline form.
Creatinine is a degradation product formed when creatine loses water and cyclizes. It can appear during storage, processing, or analysis if conditions are harsh. Quality specifications often set a maximum limit for creatinine to control purity.
No universal testing protocol applies across all markets. Some products follow pharmacopeial monographs, while others rely on manufacturer specifications and third-party certificates. Common tests include assay, water content, heavy metals, and microbial limits.
Creatine is the base compound, while creatine monohydrate is a solid crystalline form that contains one water molecule per creatine molecule. Once dissolved, the monohydrate dissociates and releases creatine, which can participate in cellular energy metabolism. The monohydrate is the form most commonly used in research and commercial products.